PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g49260.1.p
Common NameBRADI_1g49260, LOC100839073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family DBB
Protein Properties Length: 368aa    MW: 39525 Da    PI: 4.9597
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g49260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.26.7e-08447542
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       C+ +++ e++  C  ++  lC+ C +e H        H++vpl
  Bradi1g49260.1.p  4 QCNACGSAEARVLCCADEAALCAACDEEVHAAnrlagkHQRVPL 47
                      7*****************************66789999999986 PP

2zf-B_box292.2e-096194235
          zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHk 35
                      e++kC+ +++    +fC +++ llC+dC +++H 
  Bradi1g49260.1.p 61 EPPKCDICQDASGYFFCLEDRALLCRDCDVAIHT 94
                      679*****************************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.708147IPR000315B-box-type zinc finger
CDDcd000213.96E-9347No hitNo description
SMARTSM003362.3E-9447IPR000315B-box-type zinc finger
PfamPF006436.5E-6447IPR000315B-box-type zinc finger
PROSITE profilePS501198.8360107IPR000315B-box-type zinc finger
SMARTSM003363.7E-1660107IPR000315B-box-type zinc finger
PfamPF006432.4E-76194IPR000315B-box-type zinc finger
CDDcd000211.87E-864107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0009658Biological Processchloroplast organization
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010099Biological Processregulation of photomorphogenesis
GO:0015995Biological Processchlorophyll biosynthetic process
GO:0016607Cellular Componentnuclear speck
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MKIQCNACGS AEARVLCCAD EAALCAACDE EVHAANRLAG KHQRVPLLSD AHAPTAAAAA  60
EPPKCDICQD ASGYFFCLED RALLCRDCDV AIHTVNSFVS VHQRFLLTGV QVGLDPADPV  120
PPIADKHVNV SGGSVDSQMK HLPRKNPTVL FSGETSVSIP SQNAISEDYS RQSPVPNIRT  180
GMVNWTMNNS AIRSEEPPPK YLSEGSPTLL LSSQTTTAFS NQMNKDSDRA YNLPFSGGNG  240
SDSLPDWHVD EFFSNSEYGP NLGFAEHGSS KGDNAKLGSA GGSPQCRLAE GLFAEDLLGQ  300
VPGFVAEDPW VVPEVPSPPT ASGLYWQGNL RYPVYDHAMF VPEIPSLQSS QNHFTASDGS  360
KRRRREF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564326.10.0PREDICTED: B-box zinc finger protein 22-like
TrEMBLI1H1100.0I1H110_BRADI; Uncharacterized protein
STRINGBRADI1G49260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17943382
Representative plantOGRP18041634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78600.12e-52light-regulated zinc finger protein 1